STYK1 Antibody

Name STYK1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59491
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to STYK1(serine/threonine/tyrosine kinase 1) The peptide sequence was selected from the C terminal of STYK1. Peptide sequence PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene STYK1
Conjugate Unconjugated
Supplier Page Shop

Product images