POMT2 Antibody

Name POMT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59469
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POMT2(protein-O-mannosyltransferase 2) The peptide sequence was selected from the middle region of POMT2. Peptide sequence RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POMT2
Conjugate Unconjugated
Supplier Page Shop

Product images