Derlin-3 Antibody

Name Derlin-3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59467
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to Derlin-3 (Der1-like domain family, member 3) The peptide sequence was selected from the C terminal of Derlin-3 (NP_001002862). Peptide sequence YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DERL3
Conjugate Unconjugated
Supplier Page Shop

Product images