C9orf46 Antibody

Name C9orf46 Antibody
Supplier Novus Biologicals
Catalog NBP1-59462
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C9ORF46 The peptide sequence was selected from the middle region of C9ORF46. Peptide sequence AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PLGRKT
Conjugate Unconjugated
Supplier Page Shop

Product images