TMEM30B Antibody

Name TMEM30B Antibody
Supplier Novus Biologicals
Catalog NBP1-59534
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM30B(transmembrane protein 30B) The peptide sequence was selected from the middle region of TMEM30B. Peptide sequence VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMEM30B
Conjugate Unconjugated
Supplier Page Shop

Product images