SLC4A5 Antibody

Name SLC4A5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59528
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC4A5(solute carrier family 4, sodium bicarbonate cotransporter, member 5) The peptide sequence was selected from the middle region of SLC4A5. Peptide sequence SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGI
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC4A5
Conjugate Unconjugated
Supplier Page Shop

Product images