LRRC8B Antibody
| Name | LRRC8B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59628 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LRRC8B(leucine rich repeat containing 8 family, member B) The peptide sequence was selected from the middle region of LRRC8B. Peptide sequence TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC8B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LRRC8B Antibody [NBP1-59628] - Human Fetal Liver tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16068_LRRC8B%2520Antibody-Western%2520Blot-NBP1-59628-img0001.jpg)
Western Blot: LRRC8B Antibody [NBP1-59628] - Human Fetal Liver tissue lysate at a concentration of 1ug/ml.