MARCH5 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59585
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MARCH5
• Conjugate: Unconjugated