Cytochrome b245 alpha Antibody
| Name | Cytochrome b245 alpha Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59573 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYBA(cytochrome b-245, alpha polypeptide) The peptide sequence was selected from the middle region of CYBA. Peptide sequence TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYBA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cytochrome b245 alpha Antibody [NBP1-59573] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24550_Cytochrome-b245-alpha-Antibody-Western-Blot-NBP1-59573-img0003.jpg)
Western Blot: Cytochrome b245 alpha Antibody [NBP1-59573] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.
![Immunohistochemistry: Cytochrome b245 alpha Antibody [NBP1-59573] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24551_Cytochrome-b245-alpha-Antibody-Immunohistochemistry-NBP1-59573-img0004.jpg)
Immunohistochemistry: Cytochrome b245 alpha Antibody [NBP1-59573] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec