Name | ANO6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59655 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ANO6 (anoctamin 6) The peptide sequence was selected from the middle region of ANO6 (NP_001020527). Peptide sequence KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ANO6 |
Conjugate | Unconjugated |
Supplier Page | Shop |