ANO6 Antibody

Name ANO6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59655
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANO6 (anoctamin 6) The peptide sequence was selected from the middle region of ANO6 (NP_001020527). Peptide sequence KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANO6
Conjugate Unconjugated
Supplier Page Shop

Product images