Name | SV2A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59666 |
Prices | $369.00 |
Sizes | 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SV2A |
Conjugate | Unconjugated |
Supplier Page | Shop |