SV2A Antibody

Name SV2A Antibody
Supplier Novus Biologicals
Catalog NBP1-59666
Prices $369.00
Sizes 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SV2A
Conjugate Unconjugated
Supplier Page Shop

Product images