LZTFL1 Antibody

Name LZTFL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55520
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LZTFL1(leucine zipper transcription factor-like 1) The peptide sequence was selected from the C terminal of LZTFL1. Peptide sequence VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene LZTFL1
Conjugate Unconjugated
Supplier Page Shop

Product images