FBXW8 Antibody

Name FBXW8 Antibody
Supplier Novus Biologicals
Catalog NBP1-56338
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXW8(F-box and WD repeat domain containing 8) The peptide sequence was selected from the middle region of FBXW8. Peptide sequence MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXW8
Conjugate Unconjugated
Supplier Page Shop

Product images