PUS10 Antibody

Name PUS10 Antibody
Supplier Novus Biologicals
Catalog NBP1-56369
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PUS10
Conjugate Unconjugated
Supplier Page Shop

Product images