CYP11B2 Antibody

Name CYP11B2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56518
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP11B2(cytochrome P450, family 11, subfamily B, polypeptide 2) The peptide sequence was selected from the middle region of human CYP11B2. Peptide sequence RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYP11B2
Conjugate Unconjugated
Supplier Page Shop

Product images