FBP2 Antibody

Name FBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56453
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBP2(fructose-1,6-bisphosphatase 2) The peptide sequence was selected from the middle region of FBP2. Peptide sequence YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBP2
Conjugate Unconjugated
Supplier Page Shop

Product images