PELI3 Antibody

Name PELI3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56410
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PELI3(pellino homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of PELI3. Peptide sequence VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PELI3
Conjugate Unconjugated
Supplier Page Shop

Product images