UBQLN4/CIP75 Antibody

Name UBQLN4/CIP75 Antibody
Supplier Novus Biologicals
Catalog NBP1-56383
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UBQLN4/CIP75(ubiquilin 4) The peptide sequence was selected from the middle region of UBQLN4/CIP75. Peptide sequence TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UBQLN4
Conjugate Unconjugated
Supplier Page Shop

Product images