AKAP10 Antibody

Name AKAP10 Antibody
Supplier Novus Biologicals
Catalog NBP1-56509
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AKAP10
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.