VP26B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56502
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to VPS26B(vacuolar protein sorting 26 homolog B (S. pombe)) The peptide sequence was selected from the C terminal of VPS26B. Peptide sequence AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: VPS26B
• Conjugate: Unconjugated