PRAF1 Antibody
| Name | PRAF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56449 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to POLR1E (polymerase (RNA) I polypeptide E, 53kDa) The peptide sequence was selected from the N terminal of POLR1E)(50ug). Peptide sequence SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | POLR1E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PRAF1 Antibody [NBP1-56449] - Lanes: Lane1: 50 ug mouse heptoma cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: PORL1E](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29949_PRAF1-Antibody-Western-Blot-NBP1-56449-img0005.jpg)
Western Blot: PRAF1 Antibody [NBP1-56449] - Lanes: Lane1: 50 ug mouse heptoma cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: PORL1E
![Western Blot: PRAF1 Antibody [NBP1-56449] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29950_PRAF1-Antibody-Western-Blot-NBP1-56449-img0004.jpg)
Western Blot: PRAF1 Antibody [NBP1-56449] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate