ANKRD2 Antibody

Name ANKRD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56443
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD2(ankyrin repeat domain 2 (stretch responsive muscle)) The peptide sequence was selected from the N terminal of ANKRD2. Peptide sequence QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKRD2
Conjugate Unconjugated
Supplier Page Shop

Product images