NMRAL1 Antibody

Name NMRAL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56439
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Guinea Pig
Antigen Synthetic peptides corresponding to NMRAL1(NmrA-like family domain containing 1) The peptide sequence was selected from the middle region of NMRAL1. Peptide sequence TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NMRAL1
Supplier Page Shop

Product images