sFRP-2 Antibody

Name sFRP-2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56609
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Sheep
Antigen Synthetic peptides corresponding to SFRP2(secreted frizzled-related protein 2) The peptide sequence was selected from the middle region of SFRP2. Peptide sequence DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SFRP2
Supplier Page Shop

Product images