EML1 Antibody

Name EML1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56595
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EML1
Conjugate Unconjugated
Supplier Page Shop

Product images