PI 4 Kinase type 2 beta Antibody

Name PI 4 Kinase type 2 beta Antibody
Supplier Novus Biologicals
Catalog NBP1-56547
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PI4K2B(phosphatidylinositol 4-kinase type 2 beta) The peptide sequence was selected from the middle region of PI4K2B. Peptide sequence IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PI4K2B
Conjugate Unconjugated
Supplier Page Shop

Product images