AGO1/EIF2C1 Antibody
| Name | AGO1/EIF2C1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56530 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EIF2C1(eukaryotic translation initiation factor 2C, 1) The peptide sequence was selected from the N terminal of EIF2C1. Peptide sequence MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AGO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530] - THP-1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7204_AGO1-EIF2C1-Antibody-Western-Blot-NBP1-56530-img0002.jpg)
![Western Blot: AGO1/EIF2C1 Antibody [NBP1-56530] - Jurkat, Antibody Dilution: 1.0 ug/ml AGO1 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7205_AGO1-EIF2C1%2520Antibody-Western%2520Blot-NBP1-56530-img0003.jpg)