SS18L1 Antibody
| Name | SS18L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56614 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SS18L1(synovial sarcoma translocation gene on chromosome 18-like 1) The peptide sequence was selected from the middle region of SS18L1. Peptide sequence EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SS18L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SS18L1 Antibody [NBP1-56614] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7371_SS18L1-Antibody-Western-Blot-NBP1-56614-img0002.jpg)
Western Blot: SS18L1 Antibody [NBP1-56614] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: SS18L1 Antibody [NBP1-56614] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Jurkat cell lysatesS18L1 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7372_SS18L1%2520Antibody-Western%2520Blot-NBP1-56614-img0003.jpg)
Western Blot: SS18L1 Antibody [NBP1-56614] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Jurkat cell lysatesS18L1 is supported by BioGPS gene expression data to be expressed in Jurkat.