ZGPAT Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56562
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ZGPAT(zinc finger, CCCH-type with G patch domain) The peptide sequence was selected from the C terminal of ZGPAT. Peptide sequence AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ZGPAT
• Conjugate: Unconjugated