RRAGD Antibody

Name RRAGD Antibody
Supplier Novus Biologicals
Catalog NBP1-56669
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RRAGD (Ras-related GTP binding D) The peptide sequence was selected from the middle region of RRAGD)(50ug). Peptide sequence CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RRAGD
Conjugate Unconjugated
Supplier Page Shop

Product images