MYLIP Antibody

Name MYLIP Antibody
Supplier Novus Biologicals
Catalog NBP1-54903
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MYLIP(myosin regulatory light chain interacting protein) The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE.
Purity/Format Immunogen affinity purified
Blocking Peptide MYLIP Blocking Peptide
Description Rabbit Polyclonal
Gene MYLIP
Conjugate Unconjugated
Supplier Page Shop

Product images