Name | MYLIP Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54903 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MYLIP(myosin regulatory light chain interacting protein) The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE. |
Purity/Format | Immunogen affinity purified |
Blocking Peptide | MYLIP Blocking Peptide |
Description | Rabbit Polyclonal |
Gene | MYLIP |
Conjugate | Unconjugated |
Supplier Page | Shop |