UNC45A Antibody
| Name | UNC45A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54882 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UNC45A(unc-45 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC45A. Peptide sequence REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UNC45A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UNC45A Antibody [NBP1-54882] - Human Thymus lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24843_UNC45A-Antibody-Western-Blot-NBP1-54882-img0002.jpg)
Western Blot: UNC45A Antibody [NBP1-54882] - Human Thymus lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: UNC45A Antibody [NBP1-54882] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24844_UNC45A-Antibody-Immunohistochemistry-NBP1-54882-img0003.jpg)
Immunohistochemistry: UNC45A Antibody [NBP1-54882] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec