RAP1B Antibody
| Name | RAP1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54871 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAP1B(RAP1B, member of RAS oncogene family) The peptide sequence was selected from the N terminal of RAP1B. Peptide sequence MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAP1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAP1B Antibody [NBP1-54871] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24596_RAP1B-Antibody-Western-Blot-NBP1-54871-img0002.jpg)
Western Blot: RAP1B Antibody [NBP1-54871] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: RAP1B Antibody [NBP1-54871] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24597_RAP1B-Antibody-Immunohistochemistry-NBP1-54871-img0003.jpg)
Immunohistochemistry: RAP1B Antibody [NBP1-54871] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec