ICT Antibody

Name ICT Antibody
Supplier Novus Biologicals
Catalog NBP1-55014
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ICT1
Conjugate Unconjugated
Supplier Page Shop

Product images