PIMT Antibody

Name PIMT Antibody
Supplier Novus Biologicals
Catalog NBP1-54942
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TGS1(trimethylguanosine synthase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TGS1. Peptide sequence IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TGS1
Conjugate Unconjugated
Supplier Page Shop

Product images