UbcH8/Ube2L6 Antibody
| Name | UbcH8/Ube2L6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55037 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UBE2L6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: UbcH8/Ube2L6 Antibody [NBP1-55037] - Positive Control: Lane1: 70ug U6A lysate, Lane, 2: 70ug IFN-g stimulated U6A lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6944_UbcH8-Ube2L6-Antibody-Western-Blot-NBP1-55037-img0003.jpg)
![Western Blot: UbcH8/Ube2L6 Antibody [NBP1-55037] - Human Small Intestine, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6945_UbcH8-Ube2L6-Antibody-Western-Blot-NBP1-55037-img0002.jpg)