UBR1 Antibody

Name UBR1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54976
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UBR1(ubiquitin protein ligase E3 component n-recognin 1) The peptide sequence was selected from the N terminal of UBR1. Peptide sequence YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UBR1
Conjugate Unconjugated
Supplier Page Shop

Product images