Kindlin Antibody

Name Kindlin Antibody
Supplier Novus Biologicals
Catalog NBP1-54990
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human FERMT1 (NP_060141). Peptide sequence LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FERMT1
Supplier Page Shop

Product images