Name | Kindlin Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54990 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptide directed towards the N terminal of human FERMT1 (NP_060141). Peptide sequence LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | FERMT1 |
Supplier Page | Shop |