Cdc23 Antibody

Name Cdc23 Antibody
Supplier Novus Biologicals
Catalog NBP1-55022
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to CDC23(cell division cycle 23 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of CDC23. Peptide sequence RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene CDC23
Supplier Page Shop

Product images