Name | Cdc23 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55022 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to CDC23(cell division cycle 23 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of CDC23. Peptide sequence RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | CDC23 |
Supplier Page | Shop |