Name | FBXW11 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55069 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to FBXW11(F-box and WD repeat domain containing 11) The peptide sequence was selected from the N terminal of FBXW11. Peptide sequence EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | FBXW11 |
Supplier Page | Shop |