FBXW11 Antibody

Name FBXW11 Antibody
Supplier Novus Biologicals
Catalog NBP1-55052
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXW11(F-box and WD repeat domain containing 11) The peptide sequence was selected from the N terminal of FBXW11. Peptide sequence CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXW11
Conjugate Unconjugated
Supplier Page Shop

Product images