RNF169 Antibody

Name RNF169 Antibody
Supplier Novus Biologicals
Catalog NBP1-55084
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to RNF169(ring finger protein 169) The peptide sequence was selected from the N terminal of RNF169 (NP_001092108). Peptide sequence DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene RNF169
Supplier Page Shop

Product images