UbcH5c/UBE2D3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55276
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: UBE2D3
• Conjugate: Unconjugated

Product images

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF7, Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Jurkat, Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000.