Argonaute 4 Antibody

Name Argonaute 4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55239
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EIF2C4(eukaryotic translation initiation factor 2C, 4) The peptide sequence was selected from the middle region of EIF2C4 (NP_060099). Peptide sequence: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AGO4
Conjugate Unconjugated
Supplier Page Shop

Product images