BBS5 Antibody

Name BBS5 Antibody
Supplier Novus Biologicals
Catalog NBP1-55191
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BBS5(Bardet-Biedl syndrome 5) The peptide sequence was selected from the middle region of BBS5. Peptide sequence VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BBS5
Conjugate Unconjugated
Supplier Page Shop

Product images