DENND1A Antibody
| Name | DENND1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55325 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DENND1A(DENN/MADD domain containing 1A) Antibody(against the N terminal of DENND1A (NP_065997). Peptide sequence PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DENND1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DENND1A Antibody [NBP1-55325] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6931_DENND1A%2520Antibody-Western%2520Blot-NBP1-55325-img0002.jpg)
Western Blot: DENND1A Antibody [NBP1-55325] - Human Muscle lysate, concentration 0.2-1 ug/ml.