NEDD1 Antibody

Name NEDD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55320
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NEDD1(neural precursor cell expressed, developmentally down-regulated 1) The peptide sequence was selected from the N terminal of NEDD1. Peptide sequence MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NEDD1
Conjugate Unconjugated
Supplier Page Shop

Product images