GRK4 Antibody

Name GRK4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55313
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GRK4(G protein-coupled receptor kinase 4) The peptide sequence was selected from the middle region of GRK4. Peptide sequence QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GRK4
Conjugate Unconjugated
Supplier Page Shop

Product images