MED8 Antibody

Name MED8 Antibody
Supplier Novus Biologicals
Catalog NBP1-55435
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MED8(mediator complex subunit 8) The peptide sequence was selected from the N terminal of MED8. Peptide sequence MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MED8
Conjugate Unconjugated
Supplier Page Shop

Product images